PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN30926.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 259aa    MW: 29708 Da    PI: 6.9585
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN30926.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.88.6e-092042382155
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 k +yp+ +++  LA+++gL+++qV +WF N+R ++
  KHN30926.1 204 KWPYPTDADKVALAEWTGLDQKQVNNWFINQRKRH 238
                 469*****************************885 PP

2ELK331.3e-11158179122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK+ Llr Ysgy+ +L++EFs
  KHN30926.1 158 ELKDNLLRRYSGYITNLRHEFS 179
                 9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.3E-142064IPR005540KNOX1
PfamPF037902.3E-152260IPR005540KNOX1
SMARTSM012561.4E-1972123IPR005541KNOX2
PfamPF037911.2E-2177122IPR005541KNOX2
PROSITE profilePS5121310.545158178IPR005539ELK domain
PfamPF037891.1E-10158179IPR005539ELK domain
SMARTSM011886.9E-7158179IPR005539ELK domain
PROSITE profilePS5007112.293178241IPR001356Homeobox domain
SuperFamilySSF466892.27E-19179250IPR009057Homeodomain-like
SMARTSM003891.1E-11180245IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.5E-26183244IPR009057Homeodomain-like
CDDcd000861.70E-12193241No hitNo description
PfamPF059206.4E-16198237IPR008422Homeobox KN domain
PROSITE patternPS000270216239IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MAPFAPSNKP VFGKEEDVSK VLRAKVASHP LFPHLLHAYM DCHKVGAPQD VAHLLEGIKG  60
EHTSGVCQIS ESEGFLGTDP ELDDFMGTFC DLLVKYKSDL LKPFNEATMF LNLMETQLHS  120
ICNNTPPQPD EVTHGSPGKD LSRVKKEAIE GKRMEVQELK DNLLRRYSGY ITNLRHEFSK  180
KKKKEKLPKE AKQILLSWWN VHFKWPYPTD ADKVALAEWT GLDQKQVNNW FINQRKRHWK  240
PTEEMHAEIL DGLYGSLDE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150352e-34AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006578641.10.0PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS67e-83KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLK7KKY50.0K7KKY5_SOYBN; Uncharacterized protein
STRINGGLYMA04G35850.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62034125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.14e-79KNOTTED1-like homeobox gene 6